Scaffold Ga0315905_10236228

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0315905_10236228

Scaffold Ga0315905_10236228

Overview

Basic Information
Taxon OID	3300032092 Open in IMG/M
Scaffold ID	Ga0315905_10236228 Open in IMG/M
Source Dataset Name	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1781
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location Name	USA: Lake Erie, Ohio
Coordinates	Lat. (^o)	41.8268	Long. (^o)	-83.1913	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099167	Metagenome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0315905_102362283	F099167	N/A	MNLVMNSKILKRTIDIAKAMCPLNLEHRCSHIAFLIKCGKIVHIGTNSCKSHPETLKYDYKNHQLVGLHAELSVCMKSGKEDLRDFKMVVLRVDRTGKLNNSKPCCGCQSVIKQFNVGEVWYSDSNGDVVKNEN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.