Scaffold Ga0315905_10071818

Overview

Basic Information

• Taxon OID: 3300032092
• Scaffold ID: Ga0315905_10071818
• Source Dataset Name: Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3504
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 12 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Lake Erie, Ohio
• Coordinates
  • Lat. (^o): 41.8268
  • Long. (^o): -83.1913
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095011	Metagenome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315905_100718188	F095011	GAGG	MKQSDYSRLEDMLGRAYELAAQVVNGEKADTSLAEEVSGECAELLALMDGDMGAFGEEELIDKELQSLAFALNKETK