Scaffold Ga0326721_10293968

Overview

Basic Information

• Taxon OID: 3300032080
• Scaffold ID: Ga0326721_10293968
• Source Dataset Name: Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 903
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Marine Airborne Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Oklahoma
• Coordinates
  • Lat. (^o): 36.36
  • Long. (^o): -97.29

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077758	Metagenome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326721_102939682	F077758	N/A	VRSRLAARFYTGPLGHLVAGIADWGELLVRWKWSRVRERFRRASSGR