Scaffold Ga0326631_106436

Overview

Basic Information

• Taxon OID: 3300032072
• Scaffold ID: Ga0326631_106436
• Source Dataset Name: Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) (v2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 714
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Czech Republic: South Bohemian Region
• Coordinates
  • Lat. (^o): 49.044
  • Long. (^o): 13.617

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009091	Metagenome / Metatranscriptome	323	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326631_1064362	F009091	GGCGG	MRRFRTSLVVFALFAGVCLAQSAEELESPAVNRIATRLNCPCGCKTNMACRMDPYPCRTCWDNKKKILKMEQAGMSEQAILASFASDMGPNTVVVPPGILGSLSFYTAAALGLILVVFVIRKLSRKEAAVAGGGPPHDPLLDRYHDQIEKERIERELDKLD