Scaffold Ga0315906_10865342

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0315906_10865342

Scaffold Ga0315906_10865342

Overview

Basic Information
Taxon OID	3300032050 Open in IMG/M
Scaffold ID	Ga0315906_10865342 Open in IMG/M
Source Dataset Name	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	699
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location Name	USA: Lake Erie, Ohio
Coordinates	Lat. (^o)	41.7464	Long. (^o)	-83.3444	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101020	Metagenome	102	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0315906_108653422	F101020	AGGA	MNQVIKTADGYMVLMSNEDYACDAQGNNTWDTFNEAREVLCTLTVTKQEETARIFGQHYAYVHPSYTKHWERKEIATTFYTPKSKSWYAFIRGMERHEQFPVIDKGAKADIRGVLKRLTESADKYIEDGKWIVALSKDIADAKYIMEHNL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.