Scaffold Ga0326512_11022931

Overview

Basic Information

• Taxon OID: 3300032038
• Scaffold ID: Ga0326512_11022931
• Source Dataset Name: Bovine rumen microbial communities from UC Davis, California, United States - 1_2617_0518
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 610
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 38.5357
  • Long. (^o): -121.7593

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102209	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326512_110229312	F102209	GGAGG	LTSKSVTTMKIPKKKDDESLAMWCERLARELNLDEKTQELIREVSITSYIFGTNTIIDTLKKEGRL