Scaffold Ga0326509_1222572

Overview

Basic Information

• Taxon OID: 3300032036
• Scaffold ID: Ga0326509_1222572
• Source Dataset Name: Metatranscriptome of bovine rumen microbial communities from UC Davis, California, United States - 2_2465_0518 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 664
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 38.5357
  • Long. (^o): -121.7593

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027710	Metagenome / Metatranscriptome	193	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326509_12225721	F027710	N/A	MKKDKLYVLVDKSLRPVYGCVQGGHAVAQWMLEHPGQTWNNNYLIYLSADVRKWKSRLDVMDIDYSEFKEPDLNNKTTALAVH