Scaffold Ga0315278_10034205

Overview

Basic Information

• Taxon OID: 3300031997
• Scaffold ID: Ga0315278_10034205
• Source Dataset Name: Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4910
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location

• Location Name: USA: Wyoming
• Coordinates
  • Lat. (^o): 44.5094
  • Long. (^o): -110.5094
  • Depth (m): 88

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090577	Metagenome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315278_100342057	F090577	GAGG	MGVSLKTEKRRSHCPVFSFRPRVRRAEGLPGMTTEDLHGDERRSAPPALLPLICMVS