Scaffold Ga0308176_10240330

Overview

Basic Information

• Taxon OID: 3300031996
• Scaffold ID: Ga0308176_10240330
• Source Dataset Name: Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1730
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Leaf Surface Microbial Communities From Various Plants In Uc Gill Tract Community Farm, Albany, California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 37.8864
  • Long. (^o): -122.2981

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071622	Metagenome / Metatranscriptome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0308176_102403302	F071622	GAGG	MKDGKPNNAGDPGGRHAASGRRGGGAKKQRGFVERATAMGHSGHGSESVRPHLRDQLKLKSLLPQPFPTPEQENGKDEVHR