Scaffold Ga0326510_1245604

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0326510_1245604

Scaffold Ga0326510_1245604

Overview

Basic Information
Taxon OID	3300031961 Open in IMG/M
Scaffold ID	Ga0326510_1245604 Open in IMG/M
Source Dataset Name	Metatranscriptome of bovine rumen microbial communities from UC Davis, California, United States - 3_2548_0518 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	567
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	38.5357	Long. (^o)	-121.7593	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057037	Metagenome / Metatranscriptome	136	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326510_12456042	F057037	N/A	MIVLEFTDDKFGKAMKAISEIGKHSECLAAIFEDLASDSEYGERGHKYYDDDDDMYGSRYGMRRGRRRY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.