Scaffold Ga0315904_10753286

Overview

Basic Information

• Taxon OID: 3300031951
• Scaffold ID: Ga0315904_10753286
• Source Dataset Name: Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 809
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Pirellula → unclassified Pirellula → Pirellula sp. SH-Sr6A (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Lake Erie, Ohio
• Coordinates
  • Lat. (^o): 41.6898
  • Long. (^o): -83.2813
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022822	Metagenome	212	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0315904_107532861	F022822	N/A	ADAIRKVALRLDRAFATGVVACIDANQIAEILLSIAEELDPPLPNRETTPTSEE