Scaffold Ga0310884_11043900

Overview

Basic Information

• Taxon OID: 3300031944
• Scaffold ID: Ga0310884_11043900
• Source Dataset Name: Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 509
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From West Virginia University Organic Research Farm, Morgantown, Wv, United States

Source Dataset Sampling Location

• Location Name: USA: West Virginia
• Coordinates
  • Lat. (^o): 39.6475
  • Long. (^o): -79.9369

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067717	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0310884_110439001	F067717	N/A	TVLSISMAVLSTVRIQPLRRESDALLVRSRAHADAFASSFDGQFADRQLDTFQQRREIVSRVQSWQRLQLLGALGTFGGLFAVWLLWMLGRLHADLAMEPP