NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308175_100854115

Scaffold Ga0308175_100854115


Overview

Basic Information
Taxon OID3300031938 Open in IMG/M
Scaffold IDGa0308175_100854115 Open in IMG/M
Source Dataset NameSoil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)999
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Leaf Surface Microbial Communities From Various Plants In Uc Gill Tract Community Farm, Albany, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.8864Long. (o)-122.2981Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000280Metagenome / Metatranscriptome1383Y
F025713Metagenome / Metatranscriptome200Y
F065748Metagenome / Metatranscriptome127Y

Sequences

Protein IDFamilyRBSSequence
Ga0308175_1008541151F065748N/AGCQKLEAFVHAEAEGAVRIHCYTTWDTPEQLEAFLERGYTLERMLVDVAGITAQPTLVMEKIF
Ga0308175_1008541152F000280GGAGMAAGEPEGRQTPARPLVGYRDVGEDVRHSRGSLIRAWIILAALVIFYLGWTLIVFFLEPGLR
Ga0308175_1008541153F025713GAGLYVKHLTSLQFLTYVAFFAVVLGAMFRFVPGKAPPVRREPYPEDELGAHDRKTAKYFVAGGFFLVLGSLHMVVKNLPWVAEYTARTGYAGHLVRDLSNTHVMIVGGGTLLATGLCWLVLPRIVRRPLTSEGLAQCAFWFTVLGLFVFYVSLVGNGIAIGRLVEHGWSYQLAKQHMGKWYKVPTGIGAGVMGLGYWCFASNV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.