Scaffold Ga0306923_10454388

Overview

Basic Information

• Taxon OID: 3300031910
• Scaffold ID: Ga0306923_10454388
• Source Dataset Name: Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1453
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location

• Location Name: Puerto Rico: Rio Grande
• Coordinates
  • Lat. (^o): 18.321
  • Long. (^o): -65.8172
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071556	Metagenome / Metatranscriptome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0306923_104543883	F071556	N/A	VAGEVADLAAPVPTAPSAEAETEGCLIVDPAGNVLQPAGDRYIRHGNCLEQPLDRIWAEIPARAAIISNKRWLSVLS