NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315318_10552685

Scaffold Ga0315318_10552685


Overview

Basic Information
Taxon OID3300031886 Open in IMG/M
Scaffold IDGa0315318_10552685 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)654
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.7468Long. (o)-122.0193Alt. (m)Depth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004843Metagenome421Y
F049706Metagenome / Metatranscriptome146Y

Sequences

Protein IDFamilyRBSSequence
Ga0315318_105526851F049706N/AKENNNKMKFEKDHPYMKRLDETLKQYSVVKVSDTNGAHHGEDYEEMKQVILDALFMRYAGETIRK
Ga0315318_105526852F004843AGGAMIKWIFIIAIALSLNGCADTADAEDSTEVTPAEQSLEKTTLTKTDTKWIAIVMTWNPVIRTIDKEFSSELDCWNYYDTGVGESKMLNSYGTQILDHQGNKPDKEYMKTNRPPHREYPIRLYRGITDEQGQVWLTCDIKGRIEGL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.