Scaffold Ga0308404_1014979

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0308404_1014979

Scaffold Ga0308404_1014979

Overview

Basic Information
Taxon OID	3300031878 Open in IMG/M
Scaffold ID	Ga0308404_1014979 Open in IMG/M
Source Dataset Name	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M4
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1780
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location Name	USA: Wyoming
Coordinates	Lat. (^o)	44.5341	Long. (^o)	-110.798	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050963	Metagenome / Metatranscriptome	144	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0308404_10149794	F050963	N/A	METTRDVREQRAALYAALVAYLEKLSLEKDRTHYASRRWWRAILIKFPKLAIIVSLIAATYSMFQPNPKYGATIAIILSILPLAYFGLIFLGGPALFSRTYNNRSLTEVPFYLRAYFLHSAVEFAYLRCFNNLVTLRDLDEGRVNKEKR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.