NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315909_10001352

Scaffold Ga0315909_10001352


Overview

Basic Information
Taxon OID3300031857 Open in IMG/M
Scaffold IDGa0315909_10001352 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)33120
Total Scaffold Genes51 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)45 (88.24%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.7464Long. (o)-83.3444Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009952Metagenome / Metatranscriptome310Y
F088805Metagenome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0315909_1000135212F009952GAGGMQHADIGRVIRDTQLNLFQARDAVFLARCRLLAAEVCRKQGTVSINDIRAGIELPAEMHPSVLGAVFKTKQFKAVGYTEATHPQAHARVVRVYQLTNQEGETNGQQSHA
Ga0315909_1000135224F088805GGAGGMDREAPAMSLSCHQVFMLKHFAMGWRFKLTNNVPGSWNTYWSLRRRGLVSAGSVITDTGRKVLAKELQLQAKREARP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.