Basic Information | |
---|---|
Taxon OID | 3300031852 Open in IMG/M |
Scaffold ID | Ga0307410_11338558 Open in IMG/M |
Source Dataset Name | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 627 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Maize Rhizosphere Microbial Communities From Greenhouse At Uc Davis, California, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 38.5 | Long. (o) | -121.7 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F042764 | Metagenome / Metatranscriptome | 157 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0307410_113385582 | F042764 | N/A | RGTGITYEDVMDAAQRGRRIDFEGRKARIVHLSQKSGRDTPHSARIELDLGEEYLTLLGYFSDFSGKFMEEAREHPF |
⦗Top⦘ |