NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316217_10044328

Scaffold Ga0316217_10044328


Overview

Basic Information
Taxon OID3300031813 Open in IMG/M
Scaffold IDGa0316217_10044328 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2459
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Microbial Communities From Trout Bog Lake Hypolimnion, Wisconsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)46.0411Long. (o)-89.6861Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050093Metagenome / Metatranscriptome145N
F055379Metagenome138N

Sequences

Protein IDFamilyRBSSequence
Ga0316217_100443282F055379GGAMGTWQTLLDVCPYIPIPLMAILFALGLWHEIVCSNRRVAAGIEPTSIQDSTLYKIEPSKGYKTQVANNAIGYLT
Ga0316217_100443283F050093GGAGMTEETTGVLEKELAGVNQQIVRLEKYKTALNAALLARLDLDGFISARPQVYSPQTVTFTALTEGKDSPNARPNSLEMARVVLLNLDGEEKTPDEIRALIKKTYGIGPAKTLDQMLYKRASKGTMFYKTAEGRFGLLALRATTEEVRTPTTAVA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.