Scaffold Ga0310124_10421534

Overview

Basic Information

• Taxon OID: 3300031804
• Scaffold ID: Ga0310124_10421534
• Source Dataset Name: Marine microbial communities from Western Arctic Ocean, Canada - CB11b_AW_Bot5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 791
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location

• Location Name: Canada: Western Arctic Ocean
• Coordinates
  • Lat. (^o): 79.9957
  • Long. (^o): -149.9767
  • Depth (m): 800

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062154	Metagenome / Metatranscriptome	131	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0310124_104215341	F062154	N/A	MQLPRKAVGVNGVKVLSVVNARPERLVNSVANGVRVPSVVNARPERLVNRAVNGVRVPSVVNVRPELVVRVVRVDHSSVAAVVREAQVVFCGCFL