Scaffold Ga0318576_10135379

Overview

Basic Information

• Taxon OID: 3300031796
• Scaffold ID: Ga0318576_10135379
• Source Dataset Name: Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1144
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location

• Location Name: Puerto Rico: Rio Grande
• Coordinates
  • Lat. (^o): 18.321
  • Long. (^o): -65.8172
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030407	Metagenome	185	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0318576_101353792	F030407	GGA	MKPEHDERFRRIADDYLDRPGGDYAELLARGEVSSPDGVDPEQWRAEIRSKARADKIRVMTIRSGDRAIAVRRLSIPKDQELAVLSAAMQRGELLRGVAERARQLGHEIVRWVAHDQENIAMCPRCHARMYVRLDAVPQV