NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315900_10139440

Scaffold Ga0315900_10139440


Overview

Basic Information
Taxon OID3300031787 Open in IMG/M
Scaffold IDGa0315900_10139440 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2267
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.6898Long. (o)-83.2813Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000645Metagenome / Metatranscriptome962Y
F005585Metagenome / Metatranscriptome395Y
F005878Metagenome / Metatranscriptome387Y
F085644Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0315900_101394402F005585GAGVTGSRTLVTPSMTGGLNMATRGTIFYAFTKSRDNSVFSSETHLTWRLSLSQQNYQEWWKVQSAKIRISISLDMPLSYLSADLVHQKIGTTLSLTRNHNQHQWCDTCKKRYGQLKDGSWHLKAQVPAVWKVQSETPNRRMQVRFYCQPCADEVQNWPDGTFWSLKEQLQAAIDDFAGREQLDVKLS
Ga0315900_101394403F000645GGAGMSNYLDDYVSVQDRLKEFINAYPDYRIKTHVLEESLTPNCDVYIVKTELYRTEADAAAWTTGLSSESKQKQYALELAETGSLGRALNLAGYFAKPNQTPKKPIQTTKPALAEFVKEQRPNDPEPIVWDVSAIAEELGAEVIDEIPICNHGPMILKQGSKEGKEYRGWVCTERDKSRQCSAKWMKIGSDGKWAFQK
Ga0315900_101394404F005878GGAMGVSEVINEMHPFKCGPCKKVTPHHYITKYESEIEPDAWVWLMECQNCFEQRLFDPIDRVISREDEITRCDQCGNYKMKAAKCRICKIADGQERIKERYWNGNATLERFIDADI
Ga0315900_101394406F085644AGGMAKPHSLKYIKQLLEWGFDKEFIARDMGVNLASLEVRLNRAKKREQDGNQGSKSETSSD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.