Scaffold Ga0315908_10147556

Overview

Basic Information

• Taxon OID: 3300031786
• Scaffold ID: Ga0315908_10147556
• Source Dataset Name: Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1927
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Lake Erie, Ohio
• Coordinates
  • Lat. (^o): 41.8268
  • Long. (^o): -83.1913
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002397	Metagenome / Metatranscriptome	563	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315908_101475561	F002397	N/A	MTYENFLEQVNLAEQLTSSDFGVSTGLIAQGYWESSKWYFVNVERGNIADKLQPRNINVSFTNNNNVTIDIIIFTFYSDQLTIDVETGIVT