NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315899_10114708

Scaffold Ga0315899_10114708


Overview

Basic Information
Taxon OID3300031784 Open in IMG/M
Scaffold IDGa0315899_10114708 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2766
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.8268Long. (o)-83.1913Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001059Metagenome / Metatranscriptome790Y
F015330Metagenome / Metatranscriptome255Y
F027490Metagenome / Metatranscriptome194Y

Sequences

Protein IDFamilyRBSSequence
Ga0315899_101147081F015330AGGAMATVTKLKRPPGRPSVVNKVTEYGALFNRLNAEREAQGLPALKTAMEVLIEAMQSDELDIKDKARIADKLAPFESSRAPIISIEHVQNSLRDEEEDADGAMENFLESLRKV
Ga0315899_101147083F027490GAGGMSGYGQVLSGGASMRKGLTKNINDKVDGHNNDLKRKEAVAGAVNNAYKVNTLSSQHTNNVKNPGKFTKPSVPSKV
Ga0315899_101147086F001059GGAGMATYDIEALKADLPNARELAQFVYDKTNGEIALDLIGKPKEDQYQVAKNALEGKKIPADYLTNANPYVDKKETIPVDEKRKLPERSADLPPIDNRVNFFGAFNMPHPQDPQGDKKVQINFWKYDNGLITYQIMGPTEMIPVGEKINKYGQTVPERYSWIDPRTTELVLRNIDGTYTTAGRGLYAYCSGEKGAGIWSMIDKSTMAIAAKNITDPWA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.