NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315907_10030935

Scaffold Ga0315907_10030935


Overview

Basic Information
Taxon OID3300031758 Open in IMG/M
Scaffold IDGa0315907_10030935 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4836
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (12.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.6898Long. (o)-83.2813Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002739Metagenome / Metatranscriptome533Y
F091908Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0315907_1003093511F002739AGGMAKKVKVTADGEKHVVYKKTTKLGKGKPGNIMVNHPTKDKGKWDTIDLTKKAGAKTVAQGVAATKKWHKENPYPKPNKKK
Ga0315907_1003093515F091908N/AMTGSMKNPNKYPEVVTKPTPYKGGKNTYPTVVTNPTRYKGGLNKAATDIPTGKLKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.