Scaffold Ga0315293_10001759

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0315293_10001759

Scaffold Ga0315293_10001759

Overview

Basic Information
Taxon OID	3300031746 Open in IMG/M
Scaffold ID	Ga0315293_10001759 Open in IMG/M
Source Dataset Name	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	21028
Total Scaffold Genes	20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	16 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location Name	USA: Wyoming
Coordinates	Lat. (^o)	44.5395	Long. (^o)	-110.3891	Alt. (m)		Depth (m)	61
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088154	Metagenome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315293_1000175919	F088154	AGGAG	MQSWVLYGTIWFIVWVVSLWLVWRMVDRKDLNRALWIILCIFFPVIILIVVALLPAKQRKEPPEMLP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.