NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307468_100012282

Scaffold Ga0307468_100012282


Overview

Basic Information
Taxon OID3300031740 Open in IMG/M
Scaffold IDGa0307468_100012282 Open in IMG/M
Source Dataset NameHardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3420
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil → Hardwood Forest Soil Microbial Communities From Various Locations In The United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)39.0844Long. (o)-86.4705Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001110Metagenome / Metatranscriptome775Y
F004687Metagenome / Metatranscriptome428Y

Sequences

Protein IDFamilyRBSSequence
Ga0307468_1000122822F004687AGGMFLRHARLTRLAVVYLLFTVTLMMVPKADISETPFDEANTPTNEIVVKKDASLWEHRQSVTAYVPRIFAQPRRTSVCRIFPVYAGRLTDSRTVREILCSLLC
Ga0307468_1000122823F001110N/AMNNTLVAGVSRIALHLWVILIAGAVGIAATCRWCLEADEARAQRAQRKQKKELRALADKISTYGHRVHQRYPTGDVVVSEHDLAEELRKRPDTVATALNLLLGEERAQKAPLNGYWKLNV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.