Scaffold Ga0316577_10373185

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0316577_10373185

Scaffold Ga0316577_10373185

Overview

Basic Information
Taxon OID	3300031733 Open in IMG/M
Scaffold ID	Ga0316577_10373185 Open in IMG/M
Source Dataset Name	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	810
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Salt Marsh Grasses In Alabama, United States

Source Dataset Sampling Location
Location Name	USA: Alabama
Coordinates	Lat. (^o)	30.2619	Long. (^o)	-88.2383	Alt. (m)		Depth (m)	.05 to .07
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084253	Metagenome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316577_103731851	F084253	N/A	KAAQGFSARRTSVRRNRKPAENADQDKKGHFWMDTIY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.