Scaffold Ga0316577_10161810

Overview

Basic Information

• Taxon OID: 3300031733
• Scaffold ID: Ga0316577_10161810
• Source Dataset Name: Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1263
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Salt Marsh Grasses In Alabama, United States

Source Dataset Sampling Location

• Location Name: USA: Alabama
• Coordinates
  • Lat. (^o): 30.2619
  • Long. (^o): -88.2383
  • Depth (m): .05 to .07

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080659	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316577_101618102	F080659	AGGAG	MTGIPILDAILDLIMQYRLGIAMIGLAVVAVGLLMRPVAPEWSANNRAAVAAMVIGGIVLTLLPTLATAIVGG