NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307405_10001887

Scaffold Ga0307405_10001887


Overview

Basic Information
Taxon OID3300031731 Open in IMG/M
Scaffold IDGa0307405_10001887 Open in IMG/M
Source Dataset NameMaize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9001
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (77.78%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Maize Rhizosphere Microbial Communities From Greenhouse At Uc Davis, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.5Long. (o)-121.7Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048058Metagenome / Metatranscriptome148Y

Sequences

Protein IDFamilyRBSSequence
Ga0307405_100018872F048058AGGAGGMSNKAKKNQLPLALELAEPKLIAGEVDIQLSSRTNTRQQSATFSALGVLSDIAVDVAIDDVIA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.