Scaffold Ga0307469_10876711

Overview

Basic Information

• Taxon OID: 3300031720
• Scaffold ID: Ga0307469_10876711
• Source Dataset Name: Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 829
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil → Hardwood Forest Soil Microbial Communities From Various Locations In The United States

Source Dataset Sampling Location

• Location Name: USA: Indiana
• Coordinates
  • Lat. (^o): 39.0844
  • Long. (^o): -86.4705

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011532	Metagenome / Metatranscriptome	290	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307469_108767112	F011532	GAGG	MSNCVVNSGGSRLPCSPIAEHSVEGCDHFSHDGDDDDLGFFVGGGEAFVEGLEGGAVTACAEGGHVEDVTDRHPTTKDA