Basic Information | |
---|---|
Taxon OID | 3300031716 Open in IMG/M |
Scaffold ID | Ga0310813_10849005 Open in IMG/M |
Source Dataset Name | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 825 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Experimental Microcosm In Duke University, North Carolina, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: North Carolina | |||||||
Coordinates | Lat. (o) | 36.0 | Long. (o) | -78.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F089076 | Metagenome | 109 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0310813_108490052 | F089076 | N/A | NLEEIEIISYWNELLKRNEYSALAQSFNCNENMLQNVLSIEASEILKNYSASNPNGFYIDARVKDNAVLPELQKALIYGLNNTEYVKQRLSLRKKDLETLIDKVTAEIQKLDSVKKSIERVITSGEKNSSSFMLDIPGVNKEFIDMNEKLLSYREELQFSTSGIQVLQSFVPLNTPVSISLRVMILLGILFCLFTAFIFTIAHSVSERLKKRASSNA |
⦗Top⦘ |