NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310686_108187751

Scaffold Ga0310686_108187751


Overview

Basic Information
Taxon OID3300031708 Open in IMG/M
Scaffold IDGa0310686_108187751 Open in IMG/M
Source Dataset NameFICUS49499 Metagenome Czech Republic combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)899
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location NameCzech Republic: South Bohemian Region
CoordinatesLat. (o)49.043Long. (o)13.6183Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006393Metagenome / Metatranscriptome374Y
F076283Metagenome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0310686_1081877512F076283GGAMTRQQAAEALQRALDISRELAGLADGGDLALTVSLDAERLQLLKSARAALQRMDEKDHAVLREIVALNDQALGFLEHRRRAKGRDMDMVATGKRALRAYSSTQLHR
Ga0310686_1081877513F006393GAGMPEAFLGDGLIFDEVLPAVWTAGPLAEGAVLARLNADNHQLLGAESSLDEVRVHEALKDESPALVHELQRLEYNVNILLRLTSELALRNSGLPAPQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.