Scaffold Ga0310686_102566064

Overview

Basic Information

• Taxon OID: 3300031708
• Scaffold ID: Ga0310686_102566064
• Source Dataset Name: FICUS49499 Metagenome Czech Republic combined assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1568
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Czech Republic: South Bohemian Region
• Coordinates
  • Lat. (^o): 49.043
  • Long. (^o): 13.6183

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022957	Metagenome / Metatranscriptome	212	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0310686_1025660641	F022957	N/A	MALVGVCFAIWLLRAGYIRLGCVWVAVFLWRGQQFAVWFFALGKAPSGVTAPLTSKRQRLLLSIICLLGAAVCAVGIYLWRLWPEQWQAGLVFVLFGLIVLAPVTLKEIQSRRKTLAQIQPPTTE