Scaffold Ga0308002_1019179

Overview

Basic Information

• Taxon OID: 3300031703
• Scaffold ID: Ga0308002_1019179
• Source Dataset Name: Marine microbial communities from water near the shore, Antarctic Ocean - #34
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1673
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates
  • Lat. (^o): -68.5735
  • Long. (^o): 77.9231
  • Depth (m): 24

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012283	Metagenome / Metatranscriptome	282	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0308002_10191791	F012283	AGGAG	LRNWLAALLALSCSLSSWSDPEIIEHQITDDSWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLNPLTVDGTGYIHDGLCCNGEDFTNGATGVRFNYTIM