Scaffold Ga0307998_1019595

Overview

Basic Information

• Taxon OID: 3300031702
• Scaffold ID: Ga0307998_1019595
• Source Dataset Name: Marine microbial communities from David Island wharf, Antarctic Ocean - #37
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2907
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates
  • Lat. (^o): -68.5781
  • Long. (^o): 77.9617
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050664	Metagenome / Metatranscriptome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307998_10195951	F050664	GGA	MTSSEKHKIIKAVLNVVSGISMAVIVSLGILYIGFNNAFVFNNAGIAVTNNPVTGDQINFILEGSRRHECILTKVHSDAFDDATGERFALDFARKVYL