Scaffold Ga0308016_10104719

Overview

Basic Information

• Taxon OID: 3300031695
• Scaffold ID: Ga0308016_10104719
• Source Dataset Name: Marine microbial communities from water near the shore, Antarctic Ocean - #233
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1145
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates
  • Lat. (^o): -68.5596
  • Long. (^o): 77.8957
  • Depth (m): 37

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097667	Metagenome / Metatranscriptome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0308016_101047191	F097667	N/A	MFGYLIIKYISAKINTIIIPKIVNHFAASVFINLLKISPNLYDKYETIKNLNPLENRQIMKNIDKLK