Basic Information | |
---|---|
Taxon OID | 3300031676 Open in IMG/M |
Scaffold ID | Ga0302136_1068671 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_20m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1196 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Western Arctic Ocean | |||||||
Coordinates | Lat. (o) | 80.9595 | Long. (o) | -132.1842 | Alt. (m) | Depth (m) | 20 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F055204 | Metagenome | 139 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0302136_10686711 | F055204 | GGA | MEGAAQAYAQLSEQEKEMIREVVDSPLMGILAKVFGQEFVQALGSFNKPARKMDAE |
⦗Top⦘ |