Scaffold Ga0307375_10015666

Overview

Basic Information

• Taxon OID: 3300031669
• Scaffold ID: Ga0307375_10015666
• Source Dataset Name: Soil microbial communities from Risofladan, Vaasa, Finland - TR-1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6436
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland

Source Dataset Sampling Location

• Location Name: Finland: Risofladan, Vaasa
• Coordinates
  • Lat. (^o): 63.0472
  • Long. (^o): 21.7116
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047790	Metagenome / Metatranscriptome	149	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307375_100156664	F047790	GGAG	MMMNLDDDIAAWAATVRLPDTQAAAVFQQIVATPAPGPPAAPRLDPSWWRHFTADFTARMVSSTRPVRQAV