NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307984_1016839

Scaffold Ga0307984_1016839


Overview

Basic Information
Taxon OID3300031658 Open in IMG/M
Scaffold IDGa0307984_1016839 Open in IMG/M
Source Dataset NameMarine microbial communities from Ellis Fjord, Antarctic Ocean - #78
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2540
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameSouthern Ocean
CoordinatesLat. (o)-68.5958Long. (o)78.1913Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008782Metagenome / Metatranscriptome328Y

Sequences

Protein IDFamilyRBSSequence
Ga0307984_10168392F008782N/AMKKPIFRVFVSYEIKNKAAVTRKVIMGILDTFALTSNIEEIKKDTELIDRICYLNKKNLNKVDITITNVDVEYQYGETTDRFDDEY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.