Scaffold Ga0307984_1002700

Overview

Basic Information

• Taxon OID: 3300031658
• Scaffold ID: Ga0307984_1002700
• Source Dataset Name: Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7173
• Total Scaffold Genes: 15
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 13 (86.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates
  • Lat. (^o): -68.5958
  • Long. (^o): 78.1913
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014509	Metagenome	262	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307984_10027008	F014509	GGAG	MGIILGKHNRSSAYVGRFDPANPQDMKEYEMVKAVARSCNSPKMKFRVEKKGRKPTKGFTFFGDCVGGIKNATLWDVYIYRRTYDYYNDRRIG