Scaffold Ga0308012_10063593

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0308012_10063593

Scaffold Ga0308012_10063593

Overview

Basic Information
Taxon OID	3300031647 Open in IMG/M
Scaffold ID	Ga0308012_10063593 Open in IMG/M
Source Dataset Name	Marine microbial communities from water near the shore, Antarctic Ocean - #179
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1420
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location Name	Southern Ocean
Coordinates	Lat. (^o)	-68.5596	Long. (^o)	77.8957	Alt. (m)		Depth (m)	25
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036924	Metagenome / Metatranscriptome	169	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0308012_100635931	F036924	AGAAGG	MANAGIYYGRPSTVIKVDFTENNVVSGTAFSADSSYVLLCAKTAGCHFAIGSAPVATVAGSFYLPKDEVIIIKVSGGDKISAI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.