NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228540_104755

Scaffold Ga0228540_104755


Overview

Basic Information
Taxon OID3300031642 Open in IMG/M
Scaffold IDGa0228540_104755 Open in IMG/M
Source Dataset NameMetatranscriptome of Chrysochromulina tobin associated microbial communities from unialgal haptophyte culture, Seattle, Washington, United States ? P5_L6_4mM_1 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)613
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Chrysochromulina Tobin Associated Microbial Communities From Unialgal Haptophyte Culture In Seattle, Washington, Usa

Source Dataset Sampling Location
Location NameUSA: Washington
CoordinatesLat. (o)47.6519Long. (o)-122.3113Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044875Metagenome / Metatranscriptome153Y

Sequences

Protein IDFamilyRBSSequence
Ga0228540_1047551F044875N/ASTQFIKANATNTAQVRAQRQDEKRDAQSRGNDKPQWARDAAAPKKVKGTALGEEAKKDAELVLYEFLNMLVRISFWRANPNFGLHGNKDELVPVALALSTVLNEIILPRAKRENSAAFRNKEMNDPKLLAVLENYKPKLKEWYDKKVLDDSEGKGLVSDKLGFDEWLRVLDRQDIVGEWEIEQMSEITGDESTKGNIKMRLSIP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.