Basic Information | |
---|---|
Taxon OID | 3300031638 Open in IMG/M |
Scaffold ID | Ga0302125_10135887 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Western Arctic Ocean, Canada - CB4_surface |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 789 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Western Arctic Ocean | |||||||
Coordinates | Lat. (o) | 75.0007 | Long. (o) | -150.0027 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F041865 | Metagenome | 159 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0302125_101358871 | F041865 | N/A | KIIRGNKPMKRNEASYAKVAKGEIYNYRSTLGLSQVNMAKKMGLSQRMWNHYEHGTKQVPISVVLSAKYLCQNIDKMDKLHDDIKQHEEPLTKWDVDRIEALMRAAKTKGHNSNDNDPSIARIFTQCEKEMGFLLSKIN |
⦗Top⦘ |