Scaffold Ga0302138_10098915

Overview

Basic Information

• Taxon OID: 3300031637
• Scaffold ID: Ga0302138_10098915
• Source Dataset Name: Marine microbial communities from Western Arctic Ocean, Canada - CBN3_32.1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1054
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location

• Location Name: Canada: Western Arctic Ocean
• Coordinates
  • Lat. (^o): 80.9595
  • Long. (^o): -132.1842
  • Depth (m): 86

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043077	Metagenome	157	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0302138_100989152	F043077	GGA	MFKLKFFITLIVLLCTTAFAQITGPKVGEVIGQMGTTWNEREGKTQNTSTGYELQMKDFLQTGEDGGMILNYADGTKFTMGPNTEL