NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302118_10140089

Scaffold Ga0302118_10140089


Overview

Basic Information
Taxon OID3300031627 Open in IMG/M
Scaffold IDGa0302118_10140089 Open in IMG/M
Source Dataset NameMarine microbial communities from Western Arctic Ocean, Canada - AG5_33.1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1186
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD12-C183(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)70.5467Long. (o)-122.9077Alt. (m)Depth (m)74
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022779Metagenome213Y

Sequences

Protein IDFamilyRBSSequence
Ga0302118_101400892F022779GAGMAGKRKTTAKKKSVPVRKNAVSEEVKASKLDALRNAPIQMPKSVLSARADQESKLGTGVKCGRRTSYTPDRIEALLKNVRCGLPIMRACALASIPQSNLYDWMKRYSDLSECIQQAESEYQAFALGTVNDGIANGDGHLAMKLLGARFGDEYATSKKVDVRNTHVRSSISADLLSGLQTARVEVDVVSAVNLIGTEEADTPGSKITQPSPDPDGSADDDGGAPQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.