NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302121_10121612

Scaffold Ga0302121_10121612


Overview

Basic Information
Taxon OID3300031626 Open in IMG/M
Scaffold IDGa0302121_10121612 Open in IMG/M
Source Dataset NameMarine microbial communities from Western Arctic Ocean, Canada - CB21_surface
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)757
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)74.0136Long. (o)-139.5971Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003357Metagenome / Metatranscriptome492N
F014790Metagenome / Metatranscriptome260Y

Sequences

Protein IDFamilyRBSSequence
Ga0302121_101216122F003357AGGAGGMKRNSWIVKQMFADAKNNLGWVFKGVLVAGGFVAGIKVLTFFNMPKEIVFPVMWIAFIVLMAYKWYSMKYDWSKEDKAYDRASKKYTNKLKELK
Ga0302121_101216123F014790N/ATISHGTLYALLLQPERCDFFHGVIRTFYKDNINEDGGVNMYAVGDEFAFDFVEGNKDNYMGVDMEALTDDITEDAMNDMPSEVDIALNLESDSKEGR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.