Scaffold Ga0307508_10021616

Overview

Basic Information

• Taxon OID: 3300031616
• Scaffold ID: Ga0307508_10021616
• Source Dataset Name: Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5851
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location

• Location Name: USA: Oregon
• Coordinates
  • Lat. (^o): 45.0822
  • Long. (^o): -123.061

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065129	Metagenome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307508_100216162	F065129	AGG	MAGISTTGTFEECTDELNDFIASLQRYPHTVLAFALRAHLCGLLQALQAHGMCSGAEVTAFLQELEHEALWPGEG