Scaffold Ga0307999_1026553

Overview

Basic Information

• Taxon OID: 3300031608
• Scaffold ID: Ga0307999_1026553
• Source Dataset Name: Marine microbial communities from water near the shore, Antarctic Ocean - #1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1417
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates
  • Lat. (^o): -68.5735
  • Long. (^o): 77.9231
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094383	Metagenome / Metatranscriptome	106	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0307999_10265532	F094383	N/A	MSQQLRVVNNASQAVTDSNVSSGALVVPTGLIRVVATVDSFISLTASAATVDTTGIVIAAGSENLFVVKNGSFVNGLRVGGTNGRISITCVSLGK