Scaffold Ga0307999_1000398

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307999_1000398

Scaffold Ga0307999_1000398

Overview

Basic Information
Taxon OID	3300031608 Open in IMG/M
Scaffold ID	Ga0307999_1000398 Open in IMG/M
Source Dataset Name	Marine microbial communities from water near the shore, Antarctic Ocean - #1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	12422
Total Scaffold Genes	28 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	17 (60.71%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location Name	Southern Ocean
Coordinates	Lat. (^o)	-68.5735	Long. (^o)	77.9231	Alt. (m)		Depth (m)	2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101490	Metagenome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307999_10003985	F101490	N/A	MKKYLIETLTKQLKDLRSYETSVESNWGGKKRLFKCVDAQLEIKFCKAQMLFDESLIGEDIKLKMQMIEMMNRAYSALIEKAEANGFSELEDDHRCYKYRDNKIAIVCDTEFERPRLKELYGSDKDTVLFSVEELFRFIHPDYIEAKEAFKKRNIDITFKKVSYT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.